PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_5887_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 318aa    MW: 34340.4 Da    PI: 8.3941
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_5887_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.8e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l  +v+++G+++W++I++ ++ gR++k+c++rw + 
    Neem_5887_f_1 12 KGPWSPEEDEALQLLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding56.94.7e-1866108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar ++ gRt++ +k++w++ 
    Neem_5887_f_1  66 AFTPEEDEMIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.466762IPR017930Myb domain
SuperFamilySSF466891.08E-329105IPR009057Homeodomain-like
SMARTSM007176.3E-171160IPR001005SANT/Myb domain
PfamPF002491.6E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-261365IPR009057Homeodomain-like
CDDcd001672.93E-161456No hitNo description
SMARTSM007171.8E-1563111IPR001005SANT/Myb domain
PROSITE profilePS5129421.60564113IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2466112IPR009057Homeodomain-like
PfamPF002491.8E-1566108IPR001005SANT/Myb domain
CDDcd001677.49E-1366109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MAFNRKEVDR IKGPWSPEED EALQLLVQKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRAFTPE EDEMIIRAHA RFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSSLMTGN  120
GNFGNCNGYD GDFGENCQQQ PLKRSVSAGS GLPVTTGLYM NPGSPSGSDV SDSSVPGLSS  180
NYNIFKPVAR TGGINVDVNM VPETTSSSND PPTSLSLSLP GADSPEVSNK VSEPAQAVNA  240
KPSLGGPVSC CREERSSDSG SKGFVGFSSE FMAVMQEMIR QEVRTYMAAL EQQRGGACYQ  300
GGGSGDGVFR NVAMQRIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-42111123104C-Myb DNA-Binding Domain
1msf_C4e-42111123104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425988.10.0hypothetical protein CICLE_v10026107mg
SwissprotQ9FDW11e-100MYB44_ARATH; Transcription factor MYB44
TrEMBLA5HLW50.0A5HLW5_CITSI; Putative R2R3-Myb transcription factor
TrEMBLV4RWL50.0V4RWL5_9R
STRINGPOPTR_0007s10490.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-100myb domain protein 73